PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cucsa.051050.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family MYB
Protein Properties Length: 367aa    MW: 40923.4 Da    PI: 6.5785
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cucsa.051050.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding56.85.3e-181461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g W+++Ede+l+++++++G g+W+++++  g+ R++k+c++rw +yl
   Cucsa.051050.1 14 KGLWSPDEDEKLLNYITKHGHGCWSSVPKLAGLQRCGKSCRLRWINYL 61
                     678*******************************************97 PP

2Myb_DNA-binding45.12.3e-1467110146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      rg+++++E++l+++++  lG++ W+ Ia+ ++ gRt++++k+ w++
   Cucsa.051050.1  67 RGPFSQQEEDLIIELHSVLGNR-WSQIAAQLP-GRTDNEIKNLWNS 110
                      89********************.*********.*********9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.604.2E-27664IPR009057Homeodomain-like
PROSITE profilePS5129418.626961IPR017930Myb domain
SuperFamilySSF466894.77E-3012108IPR009057Homeodomain-like
SMARTSM007178.7E-131363IPR001005SANT/Myb domain
PfamPF002497.8E-161461IPR001005SANT/Myb domain
CDDcd001671.81E-111761No hitNo description
PROSITE profilePS5129424.962116IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.3E-2565116IPR009057Homeodomain-like
SMARTSM007171.7E-1266114IPR001005SANT/Myb domain
PfamPF002493.7E-1367110IPR001005SANT/Myb domain
CDDcd001676.12E-969109No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0001944Biological Processvasculature development
GO:0009733Biological Processresponse to auxin
GO:0010089Biological Processxylem development
GO:0010119Biological Processregulation of stomatal movement
GO:0010214Biological Processseed coat development
GO:0048364Biological Processroot development
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 367 aa     Download sequence    Send to blast
MGRHSCCYKQ KLRKGLWSPD EDEKLLNYIT KHGHGCWSSV PKLAGLQRCG KSCRLRWINY  60
LRPDLKRGPF SQQEEDLIIE LHSVLGNRWS QIAAQLPGRT DNEIKNLWNS CIKKKLRQKG  120
IDPNTHKPVV SGGGGDVENE SESKLPARSN DIDNTSDEAN NNKNDTTPPL SIPIIINPHN  180
SNSQIYSQTH EFFPFQTSTT NTSSDITSDY LTFHHLNYPP NPNPNPNPNP NSLCFTLPPP  240
PIPIKTQVPN WESTTFNNNF FDAANFSWGL PDCATKAEKL NTTQLPEDMK WSEFVGNNPF  300
ILQNQEAQSQ TQTDDSMYVE STAAETGFIV EGGGGGGGWQ RQQPSSDAAV YNKHLHTLTV  360
SFGNTL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-27121165108B-MYB
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00134DAPTransfer from AT1G09540Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6818060.0LN681806.1 Cucumis melo genomic scaffold, anchoredscaffold00025.
GenBankLN7132560.0LN713256.1 Cucumis melo genomic chromosome, chr_2.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004135763.10.0PREDICTED: myb-related protein 308
TrEMBLA0A0A0M1F20.0A0A0A0M1F2_CUCSA; Uncharacterized protein
STRINGGLYMA10G28250.11e-111(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF108333103
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G26660.15e-86myb domain protein 86